About PARIS click here
Reank Style Trend News
PARIS I'm Coming
About PARIS click here
Ronaldo: El Clasico Not Determine Degree

Cristiano Ronaldo says El Clasico match at Camp Nou will not determine the battle won Spain's Primera Liga title this season.
"It's an important game for both teams, but only one of many other games," said Ronaldo as reported by the official website of Real Madrid.
"We were just one point ahead over Barcelona. Of course, El Clasico in Camp Nou will be a heavy trip for Real Madrid. But I believe we will achieve positive results," he continued.
According to Ronaldo, this is not the last fight. There are still many matches to be played both teams, and anything can happen.
Real Madrid unbeaten in all competitions this season. Finally they beat Ajax Amsterdam four goals without reply in the Champions League.
"We can win in Amsterdam. We also can do it in Barcelona," she said.
Yet Ronaldo admitted Barcelona is the team that is hard to beat, and very tough when playing in front of supporters. Barca's consistent pursuit of Real Madrid, who won the competition this season only two clubs involved.
"We have to work hard. We believe in the form of the best games, and this fight will be very interesting for both teams," Ronaldo concluded.
"It's an important game for both teams, but only one of many other games," said Ronaldo as reported by the official website of Real Madrid.
"We were just one point ahead over Barcelona. Of course, El Clasico in Camp Nou will be a heavy trip for Real Madrid. But I believe we will achieve positive results," he continued.
According to Ronaldo, this is not the last fight. There are still many matches to be played both teams, and anything can happen.
Real Madrid unbeaten in all competitions this season. Finally they beat Ajax Amsterdam four goals without reply in the Champions League.
"We can win in Amsterdam. We also can do it in Barcelona," she said.
Yet Ronaldo admitted Barcelona is the team that is hard to beat, and very tough when playing in front of supporters. Barca's consistent pursuit of Real Madrid, who won the competition this season only two clubs involved.
"We have to work hard. We believe in the form of the best games, and this fight will be very interesting for both teams," Ronaldo concluded.
Best top 10 World Airport Awards 2010
Best top 10 World Airport Awards 2010:
1. Singapura —– Singapore Changi International Airport.
2. Korea Selatan —– Incheon International Airport, Seoul.
3. Hongkong —– Hongkong International Airport.
4. Jerman —– Munich Franz Josef Strauss Airport.
5. Malaysia —– Kuala Lumpur International Airport, Sepang.
6. Swiss —– Zurich Airport.
7. Belanda —– Amsterdam Airport Schiphol.
8. China —– Beijing Capital International Airport.
9. Selandia Baru —– Auckland Airport.
10.Thailand —– Suvarnabhumi Bangkok Airport.
1. Singapura —– Singapore Changi International Airport.
2. Korea Selatan —– Incheon International Airport, Seoul.
3. Hongkong —– Hongkong International Airport.
4. Jerman —– Munich Franz Josef Strauss Airport.
5. Malaysia —– Kuala Lumpur International Airport, Sepang.
6. Swiss —– Zurich Airport.
7. Belanda —– Amsterdam Airport Schiphol.
8. China —– Beijing Capital International Airport.
9. Selandia Baru —– Auckland Airport.
10.Thailand —– Suvarnabhumi Bangkok Airport.
Harry Potter and the Deathly Hallows Part 1 soundtrack
The track listing for the Harry Potter and the Deathly Hallows Part 1 soundtrack was released on Amazon UK. - "Obliviate" – 3:01
- "Snape to Malfoy Manor" – 1:58
- "Polyjuice Potion" – 3:32
- "Sky Battle" – 3:48
- "At the Burrow" – 2:35
- "Harry and Ginny" – 1:43
- "The Will" – 3:39
- "Death Eaters" – 3:14
- "Dobby" – 3:48
- "Ministry of Magic" – 1:46
- "Detonators" – 2:23
- "The Locket" – 1:52
- "Fireplaces Escape" – 2:53
- "Ron Leaves" – 2:35
- "The Exodus" – 1:37
- "Godric's Hollow Graveyard" – 3:15
- "Bathilda Bagshot" – 3:54
- "Hermione's Parents" – 5:50
- "Destroying the Locket" – 1:10
- "Ron's Speech" – 2:16
- "Lovegood" – 3:27
- "The Deathly Hallows" – 3:17
- "Captured and Tortured" – 2:56
- "Rescuing Hermione" – 1:50
- "Farewell to Dobby" – 3:43
- "The Elder Wand" – 1:36
Song Liric : Anang and Aurel - Tanpa Bintang

Song Liric : Anang and Aurel - Tanpa Bintang
Sepi ini takkan membunuh kita
Kar'na kita selalu bersama
Bersamanya kita harus bahagia
Melawan semua aral yang ada
Bersama...
Aku dan kamu selalu bersama
Habiskan malam walau tanpa bintang
Aku dan kamu saling berpelukan
Membunuh malam hingga pagi menjelang
Bersama s'lamanya
Sepi ini takkan membunuh kita
Kar'na kita selalu bersama
Bersamanya kita harus bahagia
Melawan semua aral yang ada
Bersama...
Aku dan kamu selalu bersama
Habiskan malam walau tanpa bintang
Aku dan kamu saling berpelukan
Membunuh malam hingga pagi menjelang
Berdua s'lamanya
Cinta aku seluas samudra
Sayang aku tak akan pudar
Cinta aku, aku dan kamu s'lamanya
Aku dan kamu selalu bersama
Habiskan malam walau tanpa bintang
Aku dan kamu saling berpelukan
Membunuh malam hingga pagi menjelang
Aku dan kamu selalu bersama
Habiskan malam walau tanpa bintang
Aku dan kamu saling berpelukan
Membunuh malam hingga pagi menjelang
Berdua s'lamanya
S'lamanya
Ralph Fiennes, the actor Voldemort in HARRY POTTER
Ralph Fiennes, the actor Voldemort in HARRY POTTER, admitted that he 'suffered' because of the costumes and makeup to wear. Ralph is required to undergo the process of make-up for two and a half hours to turn it into a figure of Voldemort's terrible.
Ralph also stated that the process of make-up should be done every day and automatically he could not eat after material called prosthetics applied to her face.
Nose and dentures, also make up an uncomfortable this makes Ralph hunger every time filming. "Every day during the shoot, I had to spend two and a half hours to make up. This is the time terberatku. Besides prosthesics, my character should wear dentures. So when everyone was eating lunch, I can not. I have to take them off every time I want to eat, "said Ralph.
Schindler's List star has also had to wear tights that are often slipped! "I also had to wear suspenders because costume includes tights that are often slipped when I work. But I can still pee, costumes made specifically so that I could pull out my little friend," he added with a laugh. Thank God! Apparently not good as well yes so Voldemort?
Ralph also stated that the process of make-up should be done every day and automatically he could not eat after material called prosthetics applied to her face.
Nose and dentures, also make up an uncomfortable this makes Ralph hunger every time filming. "Every day during the shoot, I had to spend two and a half hours to make up. This is the time terberatku. Besides prosthesics, my character should wear dentures. So when everyone was eating lunch, I can not. I have to take them off every time I want to eat, "said Ralph.
Schindler's List star has also had to wear tights that are often slipped! "I also had to wear suspenders because costume includes tights that are often slipped when I work. But I can still pee, costumes made specifically so that I could pull out my little friend," he added with a laugh. Thank God! Apparently not good as well yes so Voldemort?
Show off the breast, Miyabi Appear on 'Ghost Land Coachman (Hantu Tanah Kusir)'
Japanese porn star Maria Ozawa aka Miyabi suddenly appeared in the movie Ghost Land coachman, who first played this morning. In the film she often show off the breast.
Strangely, the trailer VCDs were distributed to reporters, not listed at all Miyabi name as a player, on Wednesday (24/11/2010).
In this film serves as Pauleen Miyabi, a Japanese journalist who covered the history of Andong. He often appeared with wearing clothes that showed minimal versatile body parts.
In one set, he displayed were forced to change her clothes because her clothes exposed to spills vegetable. Settings taken in a hospital room, there is clearly Miyabi dare show his upper body still wearing jeans with short, there appearsome breasts.
In this film serves as Pauleen Miyabi, a Japanese journalist who covered the history of Andong. He often appeared with wearing clothes that showed minimal versatile body parts.
In one set, he displayed were forced to change her clothes because her clothes exposed to spills vegetable. Settings taken in a hospital room, there is clearly Miyabi dare show his upper body still wearing jeans with short, there appearsome breasts.
Saudi Arabia's King was ill , Ahmadinejad's Get Well Wish
King of Saudi Arabia, Abdullah bin Abdul Aziz, was ill and would go went to the United States. Iranian President Mahmoud Ahmadinejad also called King Abdullah and pray for him cempat heal.
In a telephone conversation as reported by Iranian news network, Press TV, on Monday (11/22/2010), Ahmadinejad and King Abdullah are both calling for the need to enhance bilateral relations and cooperation among the countries in the Middle East region.
According to Ahmadinejad, the close cooperation between regional countries could help efforts to improve security in the Middle East.
In the talks, King Abdullah thanked Ahmadinejad. Saudi king is also expected the government and the Iranian people will enjoy success and prosperity.
King Abdullah will go to the United States on Monday, November 22 local time to undergo treatment for his illness. 86-year-old King has frequently complained of back pain.
King Abdullah was rushed to hospital on Friday, November 19 local time after suffering blood clots that aggravate his back pain.
Media speculation about the deteriorating health of King Abdullah's growing increasingly blowing full force on Wednesday, November 17 last.
At that time, the king announced his resignation as leader of the National Guard and handed the country's influential position it to his son, Prince Mitab bin Abdullah (57). It is a sign that the King of Saudi Arabia began to reduce some of their duties. King Abdullah has become the leader of the National Guard since 1962.
The health condition of Crown Prince, Prince Sultan bin Abdul Aziz, who served the Saudi defense minister, also not good. He was often in the past two years overseas in recent years due to undergo treatment for his illness. It is not clear what illness but circulating allegations that the prince was suffering from cancer.
In a telephone conversation as reported by Iranian news network, Press TV, on Monday (11/22/2010), Ahmadinejad and King Abdullah are both calling for the need to enhance bilateral relations and cooperation among the countries in the Middle East region.
According to Ahmadinejad, the close cooperation between regional countries could help efforts to improve security in the Middle East.
In the talks, King Abdullah thanked Ahmadinejad. Saudi king is also expected the government and the Iranian people will enjoy success and prosperity.
King Abdullah will go to the United States on Monday, November 22 local time to undergo treatment for his illness. 86-year-old King has frequently complained of back pain.
King Abdullah was rushed to hospital on Friday, November 19 local time after suffering blood clots that aggravate his back pain.
Media speculation about the deteriorating health of King Abdullah's growing increasingly blowing full force on Wednesday, November 17 last.
At that time, the king announced his resignation as leader of the National Guard and handed the country's influential position it to his son, Prince Mitab bin Abdullah (57). It is a sign that the King of Saudi Arabia began to reduce some of their duties. King Abdullah has become the leader of the National Guard since 1962.
The health condition of Crown Prince, Prince Sultan bin Abdul Aziz, who served the Saudi defense minister, also not good. He was often in the past two years overseas in recent years due to undergo treatment for his illness. It is not clear what illness but circulating allegations that the prince was suffering from cancer.
suddenly into the mind wants to go to BALI
There are many tourist objects that can be visited on this island. And one of them is Kuta Beach. This Kuta Beach is an international beach quality, especially for surfers, because Kuta has waves for them.
Beside the waves, Kuta is also known for its amazing beauty of the sunset.
Bali is an Indonesian island located in the westernmost end of the Lesser Sunda Islands, lying between Java to the west and Lombok to the east. It is one of the country's 33 provinces with the provincial capital at Denpasar towards the south of the island.
With a population recorded as 3,551,000 in 2009,the island is home to the vast majority of Indonesia's small Hindu minority. About 93.2% of Bali's population adheres to Balinese Hinduism, while most of the remainder follow Islam. It is also the largest tourist destination in the country and is renowned for its highly developed arts, including dance, sculpture, painting, leather, metalworking, and music.
With a population recorded as 3,551,000 in 2009,the island is home to the vast majority of Indonesia's small Hindu minority. About 93.2% of Bali's population adheres to Balinese Hinduism, while most of the remainder follow Islam. It is also the largest tourist destination in the country and is renowned for its highly developed arts, including dance, sculpture, painting, leather, metalworking, and music.
'Harry Potter and the Deathly Hallows Part 1': The Master of Darkness
Harry Potter had walked away leaving his childhood fantasies, along with the development of age himself and the fans. Thirteen years have passed since the publication of JK Rowling's first book, and 9 years since wide-screen version of a worldwide phenomenon, it was now time to part. Harry Potter's latest movie is split in two, and the first featured as a fantasy drama that is more mature, adult and "humane" than previous films, without losing his magic power.
'Harry Potter and the Deathly Hallows Part 1' is opened with the speech of the Minister of Magic Rufus Scrimgeour (Bill Nighy), who asserted that the situation is still safe and under control. It's like a rebuttal to appease the people who actually was controlled by the forces of evil from the realm of darkness. Once, after the death of Professor Dumbledore, the power of Lord Voldemort (Ralph Fiennes) is increasingly rampant, instilling his evil clutches in the Ministry of Magic, and continued his attempt to kill Harry Potter.
Through the Ministry of Magic that they have learned, Voldemort also took over control of Hogwarts School of Witchcraft and so the trio of Harry Potter, Ron and Hermione escape from there. The film depicts the adventures of a trio of witches who were growing up it after Hogwarts is no longer a place convenient to them. With escort Hagrid and Mad-Eye, they move from one place to another to escape pursuit by the people Voldemort.
Under the threat of murder, Harry and his friends must complete the unfinished mission Dumbledore, namely finding Hocrux to eliminate the darkness that rules the world. Dumbledore gave the last legacy of Deluminator to Ron, the book 'The Tales of Beetle the Bard' to Hermione, and Snitch to Harry Potter. Not only that, Harry's also got the Sword of Gryffindor heritage. However, this sword is not known to exist. Harry must go because only with that sword, Horcruxe can be solved.
Done by director David Yates, who previously working on 'The Order of The Phoenix' and 'the Half Blood Prince', 'Deathly Hollows Part 1' into a movie eksyen-exciting adventure, and presents the suspense almost without interruption from beginning to end. Interestingly, just when 'Harry Potter' series arrives on the darkest, comedy and drama elements appear more intense. In this film, we will see the trio of witches were attending a wedding reception, and thus how they explore the city of London, entered the cafe ordering Capucino.
Daniel Radcliffe, Rupert Grint and Emma Watson has grown into teenage actors to continue its action, played their respective roles in a more emotional and mature. We will see Harry Potter kiss, Ron jealous and cranky, Hermoione slapped Ron and their cohesiveness as three friends who get lost in the woods, and must work together to overcome various obstacles.
Until the first part of this latest sequel, 'Harry Potter' finds its climax. This is the best film of the entire series, in total presents a world of dark and scary. This film will make us impatient to wait for part two, which will release one more year.
'Harry Potter and the Deathly Hallows Part 1' is opened with the speech of the Minister of Magic Rufus Scrimgeour (Bill Nighy), who asserted that the situation is still safe and under control. It's like a rebuttal to appease the people who actually was controlled by the forces of evil from the realm of darkness. Once, after the death of Professor Dumbledore, the power of Lord Voldemort (Ralph Fiennes) is increasingly rampant, instilling his evil clutches in the Ministry of Magic, and continued his attempt to kill Harry Potter.
Through the Ministry of Magic that they have learned, Voldemort also took over control of Hogwarts School of Witchcraft and so the trio of Harry Potter, Ron and Hermione escape from there. The film depicts the adventures of a trio of witches who were growing up it after Hogwarts is no longer a place convenient to them. With escort Hagrid and Mad-Eye, they move from one place to another to escape pursuit by the people Voldemort.
Under the threat of murder, Harry and his friends must complete the unfinished mission Dumbledore, namely finding Hocrux to eliminate the darkness that rules the world. Dumbledore gave the last legacy of Deluminator to Ron, the book 'The Tales of Beetle the Bard' to Hermione, and Snitch to Harry Potter. Not only that, Harry's also got the Sword of Gryffindor heritage. However, this sword is not known to exist. Harry must go because only with that sword, Horcruxe can be solved.
Done by director David Yates, who previously working on 'The Order of The Phoenix' and 'the Half Blood Prince', 'Deathly Hollows Part 1' into a movie eksyen-exciting adventure, and presents the suspense almost without interruption from beginning to end. Interestingly, just when 'Harry Potter' series arrives on the darkest, comedy and drama elements appear more intense. In this film, we will see the trio of witches were attending a wedding reception, and thus how they explore the city of London, entered the cafe ordering Capucino.
Daniel Radcliffe, Rupert Grint and Emma Watson has grown into teenage actors to continue its action, played their respective roles in a more emotional and mature. We will see Harry Potter kiss, Ron jealous and cranky, Hermoione slapped Ron and their cohesiveness as three friends who get lost in the woods, and must work together to overcome various obstacles.
Until the first part of this latest sequel, 'Harry Potter' finds its climax. This is the best film of the entire series, in total presents a world of dark and scary. This film will make us impatient to wait for part two, which will release one more year.
Wedding Prince William Will Be National Holidays
Wedding day of Prince William with Kate Middleton will be a national holiday for the citizens of the United Kingdom. It is estimated that around two million people will attend the wedding ceremony.
As reported by showbizspy, Saturday, (11/20/2010), a couple who were engaged in October 2010 and was expected to marry next year in Westminster Abbey, burial place of Princess Diana.
William did not want to get married in St Paul's Cathedral because it is a place where Prince Charles and Princess Diana promise lively give-semati. As is known, William's parents marriage ended in divorce.
A number of celebrities and politicians scheduled to attend a wedding feast William and Kate Middleton. United States President Barack Obama will be a special guest on this special day.
Phil Collins, Sir Elton John, Sir Paul McCartney and Bryan Adams became a celebrity who had the honor to witness William and Kate say promise.
After the official fiancé, William had become more protective to his future wife. Kate Middleton is now always get a special escort for 24 hours.
Kate is a college friend at the University of St. William. Andrews. He is not from a noble family. The first child of three siblings born to Elizabeth and Michael Francis Carole Middleton. Michael, once worked at British Airways.
In 1987, Middleton family started building his own company, Party Pieces. The company then successfully and make the Middleton family wealthy. Kate's father was now known as one of the millionaires in the UK.
As reported by showbizspy, Saturday, (11/20/2010), a couple who were engaged in October 2010 and was expected to marry next year in Westminster Abbey, burial place of Princess Diana.
William did not want to get married in St Paul's Cathedral because it is a place where Prince Charles and Princess Diana promise lively give-semati. As is known, William's parents marriage ended in divorce.
A number of celebrities and politicians scheduled to attend a wedding feast William and Kate Middleton. United States President Barack Obama will be a special guest on this special day.
Phil Collins, Sir Elton John, Sir Paul McCartney and Bryan Adams became a celebrity who had the honor to witness William and Kate say promise.
After the official fiancé, William had become more protective to his future wife. Kate Middleton is now always get a special escort for 24 hours.
Kate is a college friend at the University of St. William. Andrews. He is not from a noble family. The first child of three siblings born to Elizabeth and Michael Francis Carole Middleton. Michael, once worked at British Airways.
In 1987, Middleton family started building his own company, Party Pieces. The company then successfully and make the Middleton family wealthy. Kate's father was now known as one of the millionaires in the UK.
unique names on the world
1. The Longest Name
Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown.
Is the name of a child in England. His name is composed of 27 words above were taken from 25 names from all over the world's top boxers and 2 the rest are first name and surname.
(Perhaps the wish that the boy's father will really be a boxer ... hehehe ...): D
2. Longest Village Name
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.
It is a village on the island of Anglesey in Wales, United Kingdom. The village is recorded in the Guinness Book of Records as the place with the longest village name in Britain.
(Pity really want to find a village if it yaaa ... hehehe ...): D
3. Hill Longest Name
Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiw
henuakitanatahu.
Is the name of a hill in Porangahau, south of Waipukurau in southern Hawke's Bay, New Zealand. The name is usually abbreviated so Taumata.
(Wahhh really easy klo hafalin yaaa short name rather than the original reply ... hehehe ...): D
4. Longest Place Name
Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajt haniburiromudomrajniweshasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit.
Is the name of a place in Thailand.
(Waahhh klo want nyari this place certainly very complicated bwt hafalinnya ... hehehe ...): D
5. Domain Names and Longest City Name
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/
Is a site to promote a town in Anglesey, Gwynedd, UK. The name of his city was the same as the name of the site.
(Well if want to campaign throughout the city but with a name that yaaa ... it's okay hell): D
6. Name E-Mail Longest
yourname@abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com
A very long name for an email address, klo liat aja want checked in ...
http://www.abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com/
(Oh why, but long-bener yaaa bwt E-mail ... hehehe ...): D
7. Longest Album Name
he Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almighty.
Is the name of an album released by former singer Sin ad O'Connor
(Do-do it was the same as the lyrics of her ... hehehe ...): D
8. Longest Association Name (in Indonesia)
IKNNYPNITDI <==> Ikatan Komikus Nggak Nyambung Yang Punya Nama Ikatan Terpanjang Di Indonesia
Is one of the names on the Indonesian community ties.
(Creative also named, although a bit too much hell ... hehehe ...): D
Hehehe ... really unique names above ...!
Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown.
Is the name of a child in England. His name is composed of 27 words above were taken from 25 names from all over the world's top boxers and 2 the rest are first name and surname.
(Perhaps the wish that the boy's father will really be a boxer ... hehehe ...): D
2. Longest Village Name
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.
It is a village on the island of Anglesey in Wales, United Kingdom. The village is recorded in the Guinness Book of Records as the place with the longest village name in Britain.
(Pity really want to find a village if it yaaa ... hehehe ...): D
3. Hill Longest Name
Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiw
henuakitanatahu.
Is the name of a hill in Porangahau, south of Waipukurau in southern Hawke's Bay, New Zealand. The name is usually abbreviated so Taumata.
(Wahhh really easy klo hafalin yaaa short name rather than the original reply ... hehehe ...): D
4. Longest Place Name
Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajt haniburiromudomrajniweshasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit.
Is the name of a place in Thailand.
(Waahhh klo want nyari this place certainly very complicated bwt hafalinnya ... hehehe ...): D
5. Domain Names and Longest City Name
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/
Is a site to promote a town in Anglesey, Gwynedd, UK. The name of his city was the same as the name of the site.
(Well if want to campaign throughout the city but with a name that yaaa ... it's okay hell): D
6. Name E-Mail Longest
yourname@abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com
A very long name for an email address, klo liat aja want checked in ...
http://www.abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com/
(Oh why, but long-bener yaaa bwt E-mail ... hehehe ...): D
7. Longest Album Name
he Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almighty.
Is the name of an album released by former singer Sin ad O'Connor
(Do-do it was the same as the lyrics of her ... hehehe ...): D
8. Longest Association Name (in Indonesia)
IKNNYPNITDI <==> Ikatan Komikus Nggak Nyambung Yang Punya Nama Ikatan Terpanjang Di Indonesia
Is one of the names on the Indonesian community ties.
(Creative also named, although a bit too much hell ... hehehe ...): D
Hehehe ... really unique names above ...!
Mas Jack - Engkaulah Cahaya Hidup Aku (ECHA)
Engkaulah Cahaya Hidup Aku (ECHA)
by : Mas Jack
arr : Habib Faishol
Entah mengapa aku selalu berharap
Kau kan menjadi selir hatiku
Angan ini melayang jauh
Ingin rasaku slalu bersamamu
** Naluriku berkata kaulah takdir hidupku
Detak jiwa ini berharap
Akankah slalu
Hatimu untukku
Reff:
Engkaulah Cahayaku
Cahaya cinta dalam hati ku
Hanya dirimu belahan jiwaku
Anugrah terindah penyejuk jiwa
Walau masih berharap
Akan hadirnya cinta
Tak kan pernah
Inginku berhenti
back to : **
Reff:
Engkaulah Cahayaku
Cahaya cinta dihati ku
Hanya dirimu belahan jiwaku
Anugrah terindah penyejuk jiwa
CPNS Gresik Tahun 2010
BUPATI GRESIK
P E N G U M U M A N
Nomor : 810/ /437.73/2010
TENTANG
PENERIMAAN CALON PEGAWAI NEGERI SIPIL DAERAH
DARI PELAMAR UMUM
PEMERINTAH KABUPATEN GRESIK FORMASI TAHUN 2010
Berdasarkan Surat Menteri Pendayagunaan Aparatur Negara Republik Indonesia Tanggal 29 Oktober 2010 Nomor : B/2756/M.PAN-RB/10/2010 Perihal Persetujuan Rincian tambahan alokasi Formasi CPNSD Tahun 2010, maka Pemerintah Kabupaten Gresik akan melaksanakan Seleksi Penerimaan Calon Pegawai Negeri Sipil (CPNS) sejumlah 229 pegawai yang terdiri dari 103 Guru, 69 Tenaga Kesehatan dan 57 Tenaga Teknis, perincian sebagaimana tercantum dalam LAMPIRAN I Pengumuman ini.
- Warga Negara Indonesia Pria dan Wanita tidak berkedudukan sebagai CPNS/PNS, TNI dan POLRI;
- Beriman dan bertaqwa pada Tuhan Yang Maha Esa;
- Setia pada NKRI yang berdasarkan Pancasila dan UUD 1945;
- Berusia serendah-rendahnya 18 (delapan belas) tahun dan setinggi-tingginya 35 (tiga puluh lima) tahun pada 1 Januari 2011;
- Berijazah serendah-rendahnya D-III dan S.1 sesuai dengan kebutuhan terlampir;
- Sehat Jasmani dan Rohani;
- Bersedia ditempatkan di mana saja di Lingkungan Pemerintah Kabupaten Gresik;
- Bagi Peserta yang lulus seleksi dan tidak melakukan pemberkasan CPNS diwajibkan mengganti keuangan Negara yang telah dipakai dalam proses seleksi CPNS sebesar Rp 25.000.000,00;
- Tidak pernah mengkomsumsi/menggunakan Narkotika, Psikotropika, Prekusor dan Zat Adiktif lainnya dibuktikan dengan Surat Bebas Narkoba dari RSUD Ibnu Sina Kabupaten Gresik;
- Tidak pernah di hukum penjara atau kurungan berdasarkan putusan pengadilan yang sudah mempunyai kekuatan hukum yang tetap, karena melakukan suatu tindak pidana kejahatan dibuktikan dengan SKCK Yang dikeluarkan Kepolisian Resort (Polres);
- Tidak pernah diberhentikan dengan hormat tidak atas permintaan sendiri atau tidak dengan hormat sebagai Pegawai Negeri Sipil/Tni/Polri atau diberhentikan tidak dengan hormat sebagai Pegawai Swasta;
- Tidak menjadi pengurus dan atau anggota Partai politik;
Berita Lengkap Download dibawah ini
Download here :
source : http://gresik.go.id/
Idul Adha 2010

Idul Adha Ditetapkan 17 November 2010
Pemerintah menetapkan hari raya Idul Adha 1431 hijriyah jatuh pada 17 November 2010. Ada perbedaan satu hari dengan organisasi Islam Muhammadiyah dan penetapan dari Pemerintah Arab Saudi. Muhammadiyah dan Arab merayakan idul qurban pada 16 November 2010.
Penetapan pemerintah itu berdasarkan hasil sidang itsbat yang dipimpin Dirjen Bimbingan Masyarakat Islam, Kemenag, Prof Dr Nasaruddin Umar. Hadir pula Sekjen Kemenag Bahrul Hayat PhD, Dirjen Peradilan Agama Mahkamah Agung Drs Wahyu Widiana MA, Ketua MUI Prof Umar Shihab, serta pimpinan ormas-ormas Islam dan anggota Badan Hisab Rukyat.
Pemerintah menetapkan 1 Dzulhijjah 1431 Hijriyah jatuh pada hari Senin, 8 November 2010. Itu artinya, hari raya Idul Adha 1431 H dilaksanakan pada pada hari Rabu, 17 November 2010.
Persidangan dimulai dengan permintaan pendapat dari peserta sidang. Pimpinan sidang, Nasaruddin mempersilahkan peserta sidang untuk menyampaikan pendapatnya. Terlebih, lebaran kali ini akan dirayakan secara berbeda. PP Muhammadiyah telah menetapkan Idul Adha jatuh pada 16 November 2010. Jadwal itu berdasar hasil sidang hisab PP Muhammadiyah.
"Pada Idul Adha 1431 hijriyah ini, kami meminta kearifan dan kebesaran hati dari Pemerintah dan semua pihak. Pada Idul Adha tahun ini, kami menetapkan berbeda, Idul Adha jatuh pada 16 November 2010," kata Ma`rifat Iman, mewakili PP Muhammadiyah.
Berbeda dengan permintaan wakil dari PBNU, KH Syaifuddin Amsir. Dia meminta ke depan tidak ada lagi perbedaan hari raya. Apalagi, dengan penetapan hari raya yang dilakukan sebagian kelompok umat seperti penganut tarikat.
Pemerintah menetapkan hari raya Idul Adha 1431 hijriyah jatuh pada 17 November 2010. Ada perbedaan satu hari dengan organisasi Islam Muhammadiyah dan penetapan dari Pemerintah Arab Saudi. Muhammadiyah dan Arab merayakan idul qurban pada 16 November 2010.
Penetapan pemerintah itu berdasarkan hasil sidang itsbat yang dipimpin Dirjen Bimbingan Masyarakat Islam, Kemenag, Prof Dr Nasaruddin Umar. Hadir pula Sekjen Kemenag Bahrul Hayat PhD, Dirjen Peradilan Agama Mahkamah Agung Drs Wahyu Widiana MA, Ketua MUI Prof Umar Shihab, serta pimpinan ormas-ormas Islam dan anggota Badan Hisab Rukyat.
Pemerintah menetapkan 1 Dzulhijjah 1431 Hijriyah jatuh pada hari Senin, 8 November 2010. Itu artinya, hari raya Idul Adha 1431 H dilaksanakan pada pada hari Rabu, 17 November 2010.
Persidangan dimulai dengan permintaan pendapat dari peserta sidang. Pimpinan sidang, Nasaruddin mempersilahkan peserta sidang untuk menyampaikan pendapatnya. Terlebih, lebaran kali ini akan dirayakan secara berbeda. PP Muhammadiyah telah menetapkan Idul Adha jatuh pada 16 November 2010. Jadwal itu berdasar hasil sidang hisab PP Muhammadiyah.
"Pada Idul Adha 1431 hijriyah ini, kami meminta kearifan dan kebesaran hati dari Pemerintah dan semua pihak. Pada Idul Adha tahun ini, kami menetapkan berbeda, Idul Adha jatuh pada 16 November 2010," kata Ma`rifat Iman, mewakili PP Muhammadiyah.
Berbeda dengan permintaan wakil dari PBNU, KH Syaifuddin Amsir. Dia meminta ke depan tidak ada lagi perbedaan hari raya. Apalagi, dengan penetapan hari raya yang dilakukan sebagian kelompok umat seperti penganut tarikat.
Do not Forget Mentawai and Wasior
Has two weeks over Mount Merapi spewed lava. Hot dust of the world's most active volcano that has claimed more than hundred people killed, destroyed property in the surrounding community, and made thousands of people are displaced. Special coverage by various media make the public attention devoted to the disaster that occurred in the border province of Yogyakarta and Central Java.
Direct broadcast several private television stations about the development of the eruption of Mount Merapi, complete with the suffering of local communities, as well as rescue teams rush-military, Red Cross, volunteers, and local communities make the Mount Merapi, a "prima donna". Not only that aid continues to flow, but state officials-executive, legislative, also goaded to take advantage of the moment.
President Susilo Bambang Yudhoyono (SBY), Vice President Boediono-each with his wife, the ministers, members of the House of Representatives, came to give special attention. There is an entertaining refugees, reviewing the barracks and kitchen and laundry room toilet (MCK). Some even tried to rations for refugees. President Yudhoyono after returning to Jakarta finally decided to head back a few days in Yogyakarta for close to disaster.
Government's attention so extraordinary. Far compared to what is experienced by regional and community Wasior (West Papua) and Mentawai (Sumatra) which also is struggling to overcome various obstacles due to the disaster. Wasior just been hit by flash floods devastated and Mentawai earthquake and tsunami. Even based on the latest developments, there are many victims in Wasior and Mentawai currently experiencing food shortages, and lived in barracks with various deficiencies.
Is the difference due to concern that the government does not have a disaster response program? Could be the case. For example yes this time, when disaster comes insistent, governments such as confusion where to start, and which ones should receive priority. Finally, either because the incessant coverage, either because of the disaster areas not so far from the Mother City, Mount Merapi, the most attention.
Although in terms of disaster deaths of Mount Merapi was still under the death toll in the Mentawai, and despite the suffering of the victims did not semenderita in Mentawai and Wasior, catastrophic eruption of Mount Merapi given priority. Evidence, the President set a five special decision for the handling of Mount Merapi. In addition to establishing the Chairman of the emergency response command BNPB as Mount Merapi, also set the Coordinating Minister for ensuring the smooth and certainty of aid, purchase of livestock affairs of citizens who become victims, and deploying military for disaster relief.
The decision was worth the envy of the Mentawai and Wasior disaster victims. Why they do not have a disaster emergency command? Why do not they get a coordinator distribution of funds, why and why? Do not forget the Mentawai and Wasior. Government should not discriminate. All citizens should have equal treatment. Do not have a reason for the disaster areas and other hard to reach one easy visit.
The government should admit defeat faster than the Red Cross, volunteers, and the army (TNI), in the face of any disaster. Despite having the National Disaster Management Agency (BNPB) whose chairperson ministerial-level, government giddy. Even BNPB impressed extend bureaucracy. In the case of assistance to victims, the private sector more efficiently and faster, and able to establish cooperation with the TNI and PMI in the distribution. It seems the government still has much to learn. To borrow the motto of which is often spoken of former Vice President Jusuf Kalla (JK), in dealing with disasters is the sooner the better. In leading the Red Cross, JK prove it.
Direct broadcast several private television stations about the development of the eruption of Mount Merapi, complete with the suffering of local communities, as well as rescue teams rush-military, Red Cross, volunteers, and local communities make the Mount Merapi, a "prima donna". Not only that aid continues to flow, but state officials-executive, legislative, also goaded to take advantage of the moment.
President Susilo Bambang Yudhoyono (SBY), Vice President Boediono-each with his wife, the ministers, members of the House of Representatives, came to give special attention. There is an entertaining refugees, reviewing the barracks and kitchen and laundry room toilet (MCK). Some even tried to rations for refugees. President Yudhoyono after returning to Jakarta finally decided to head back a few days in Yogyakarta for close to disaster.
Government's attention so extraordinary. Far compared to what is experienced by regional and community Wasior (West Papua) and Mentawai (Sumatra) which also is struggling to overcome various obstacles due to the disaster. Wasior just been hit by flash floods devastated and Mentawai earthquake and tsunami. Even based on the latest developments, there are many victims in Wasior and Mentawai currently experiencing food shortages, and lived in barracks with various deficiencies.
Is the difference due to concern that the government does not have a disaster response program? Could be the case. For example yes this time, when disaster comes insistent, governments such as confusion where to start, and which ones should receive priority. Finally, either because the incessant coverage, either because of the disaster areas not so far from the Mother City, Mount Merapi, the most attention.
Although in terms of disaster deaths of Mount Merapi was still under the death toll in the Mentawai, and despite the suffering of the victims did not semenderita in Mentawai and Wasior, catastrophic eruption of Mount Merapi given priority. Evidence, the President set a five special decision for the handling of Mount Merapi. In addition to establishing the Chairman of the emergency response command BNPB as Mount Merapi, also set the Coordinating Minister for ensuring the smooth and certainty of aid, purchase of livestock affairs of citizens who become victims, and deploying military for disaster relief.
The decision was worth the envy of the Mentawai and Wasior disaster victims. Why they do not have a disaster emergency command? Why do not they get a coordinator distribution of funds, why and why? Do not forget the Mentawai and Wasior. Government should not discriminate. All citizens should have equal treatment. Do not have a reason for the disaster areas and other hard to reach one easy visit.
The government should admit defeat faster than the Red Cross, volunteers, and the army (TNI), in the face of any disaster. Despite having the National Disaster Management Agency (BNPB) whose chairperson ministerial-level, government giddy. Even BNPB impressed extend bureaucracy. In the case of assistance to victims, the private sector more efficiently and faster, and able to establish cooperation with the TNI and PMI in the distribution. It seems the government still has much to learn. To borrow the motto of which is often spoken of former Vice President Jusuf Kalla (JK), in dealing with disasters is the sooner the better. In leading the Red Cross, JK prove it.
Concert in Indonesia, Iron Maiden vocalist Kemudikan Personal Aircraft
Heavy metal band Iron Maiden is ready to concerts in Jakarta and Bali 17 and February 20, 2011. Did You Know? The lead singer, Bruce Dickinson, will drive their own private plane when it comes to Indonesia.
That said Tommy Pratt as the boss Original Productions, the promoter who brought the Iron Maiden to Indonesia. According to him, Bruce was used to drive the aircraft itself to the countries they visit for a concert.
"In every country visited, he (Bruce), who brought his plane. It's what makes fans want to know Iron Maiden landed where nih. But he brought his own plane emang whose contents all the equipment on stage," explained Tommy during a press conference at the Hard Rock Cafe , Thamrin, Central Jakarta, Monday (08/11/2010).
The aircraft will be driven by Bruce type Boeing 757, named Ed Force One. He has been a pilot since 1990.
Iron Maiden concert in Indonesia have been anticipated by their fans for 25 years. It took five years to promoter Original Productions to convince the singer of 'Run To The Hills' is to hold a concert in Indonesia.
That said Tommy Pratt as the boss Original Productions, the promoter who brought the Iron Maiden to Indonesia. According to him, Bruce was used to drive the aircraft itself to the countries they visit for a concert.
"In every country visited, he (Bruce), who brought his plane. It's what makes fans want to know Iron Maiden landed where nih. But he brought his own plane emang whose contents all the equipment on stage," explained Tommy during a press conference at the Hard Rock Cafe , Thamrin, Central Jakarta, Monday (08/11/2010).
The aircraft will be driven by Bruce type Boeing 757, named Ed Force One. He has been a pilot since 1990.
Iron Maiden concert in Indonesia have been anticipated by their fans for 25 years. It took five years to promoter Original Productions to convince the singer of 'Run To The Hills' is to hold a concert in Indonesia.
Zainuddin MZ Attend Joint Islah with Aida, Tuesday Tomorrow
Finally the day of peace arrives! Aida and Zainuddin will meet for the first time in public. Aida said, Zainuddin already confirmed his presence, on Tuesday (11/09/2010) tomorrow.
Aida and Zainuddin will meet at the Hotel Grand Cempaka Mas, Central Jakarta at 10.00 am. In the meeting, Zainuddin will apologize to Aida openly in public.
"Yes he (Zainuddin) arrived. He's confirmation," said Aida detikhot when contacted via phone on Monday (8/11/2010).
In that meeting, Aida accompanied by parents and lawyers. In the meeting, Aida will apologize to the public because preaching is considered disturbing. While dai a million people would be apologizing to Aida.
"The meeting at 10 tomorrow. The agenda is still the same," said Aida.
Swiss Create First Mechanical Clock Based on the Islamic Calendar
A Swiss company, Parmigiani Fleurier, creating the world's first mechanical clock based on the Islamic calendar, which traces the rotation of the moon. Luxury watchmaker company that has developed a mechanical clock for 20 years and dedicate the homemade to the Muslim community.
Prototypes of these hours in Abu Dhabi was inaugurated last week by company executives together with the Director General of Tourism and Antiquities of the National Council of Tourism UAE, Mohammed Khamis bin Hareb Al-Muhairy. President of the company as well as expert watchmaker Michel Parmigiani, said the Arab peninsula is a great place to introduce it at homemade. Because the clock was menjad part of Islamic civilization.
Hijri calendar is shorter than in AD. The clock is equipped with a mechanical calendar Hegirian for 30 years continuously. While pointing hours and minutes are also equipped with a precision phase of the moon. Hours are scheduled to be launched globally in January 2011 in Geneva and delivery hours to the new buyer will be a month later.
The following specifications of these hours. Hours Hijri it weighs 17 pounds, the body clock is made of silver and decorated quartz and ruby. Bookmarks digit hours, minutes and date written in Arabic. Hours precious luxury estimated 2.6 million U.S. dollars. ''We will only produce a few units each year,''says CEO Parmigiani, Jean-Marc Jacot.
Parmigiani not be indiscriminate selling this one product. Jacot said the company will selectively determine the buyer that could bring its luxury at it. ''Just having money is not good enough criteria,''he said. Buyers''need to have a taste of culture and art.''
Prototypes of these hours in Abu Dhabi was inaugurated last week by company executives together with the Director General of Tourism and Antiquities of the National Council of Tourism UAE, Mohammed Khamis bin Hareb Al-Muhairy. President of the company as well as expert watchmaker Michel Parmigiani, said the Arab peninsula is a great place to introduce it at homemade. Because the clock was menjad part of Islamic civilization.
Hijri calendar is shorter than in AD. The clock is equipped with a mechanical calendar Hegirian for 30 years continuously. While pointing hours and minutes are also equipped with a precision phase of the moon. Hours are scheduled to be launched globally in January 2011 in Geneva and delivery hours to the new buyer will be a month later.
The following specifications of these hours. Hours Hijri it weighs 17 pounds, the body clock is made of silver and decorated quartz and ruby. Bookmarks digit hours, minutes and date written in Arabic. Hours precious luxury estimated 2.6 million U.S. dollars. ''We will only produce a few units each year,''says CEO Parmigiani, Jean-Marc Jacot.
Parmigiani not be indiscriminate selling this one product. Jacot said the company will selectively determine the buyer that could bring its luxury at it. ''Just having money is not good enough criteria,''he said. Buyers''need to have a taste of culture and art.''
Simak
Baca secara fonetik
Merapi Erupts Eating Many Victims (Pray to Indonesia)
The victim died from catastrophic eruption of Mount Merapi in Yogyakarta and Central Java, according to latest reports 116 people.
In addition to the victims died, there was also wounded, amounting to 218 people. There are 147 people in Sleman, Klaten 57 people, and Magelang 14 people, while in Boyolali no reports of victims injured by the eruption of Merapi.
Merapi eruption displaced victims of the disaster reached 198,000 people, covering as many as 56,000 people Sleman, Magelang regency (62 000), Magelang (2,000), Klaten (40,000), and Boyolali (30,000).
Place of refuge during this ever-changing due to adjusting the existing circumstances. Placement of refugees in the stadium Maguwoharjo Sleman adequate, because it can accommodate about 30,000 people, and their needs are met appropriately.
Pray hopefully Indonesia safely,without disaster..... Amiin.
In addition to the victims died, there was also wounded, amounting to 218 people. There are 147 people in Sleman, Klaten 57 people, and Magelang 14 people, while in Boyolali no reports of victims injured by the eruption of Merapi.
Merapi eruption displaced victims of the disaster reached 198,000 people, covering as many as 56,000 people Sleman, Magelang regency (62 000), Magelang (2,000), Klaten (40,000), and Boyolali (30,000).
Place of refuge during this ever-changing due to adjusting the existing circumstances. Placement of refugees in the stadium Maguwoharjo Sleman adequate, because it can accommodate about 30,000 people, and their needs are met appropriately.
Pray hopefully Indonesia safely,without disaster..... Amiin.
Subscribe to:
Posts (Atom)
Popular Posts Today
-
Game Wallpapers Hd
-
Lionel Messi Wallpaper 1 Lionel Messi Wallpaper 2 Lionel Messi Wallpaper 3 Lionel Messi Wallpaper 4 Lionel Messi Wallpaper 5
-
Happy New Year 2011 : Never Say Give Up
-
Irfan Bachdim Wallpaper 1 Irfan Bachdim Wallpaper 2 Irfan Bachdim Wallpaper 3 Irfan Bachdim Wallpaper 4 Irfan Bachdim Wallpaper 5
-
Happy New Year 2011 : should be better tomorrow
